PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc04310.1.g00020.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 639aa    MW: 69414.6 Da    PI: 6.7007
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc04310.1.g00020.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.31.7e-1572121655
                                   S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                      Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                   ++t+eq ++Le++F  +++p + +r +L++ +gL+ +qVk+WFqN+R+  
  Zpz_sc04310.1.g00020.1.sm.mk  72 RLTREQSDILESFFITCPHPIEVQRNQLSQLTGLDGNQVKFWFQNKRTHV 121
                                   689********************************************875 PP

2START79.77.2e-261573742206
                                   HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT CS
                         START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv...dsgealrasgvvdmvlallveellddkeqWdet 75 
                                   +a +a ++lv++a+++ p+W  ++    e +  +++ + f+  ++    ++ea ra +vv  ++   ve ++    ++++ 
  Zpz_sc04310.1.g00020.1.sm.mk 157 IARDAVRDLVTLASSNGPLWICVPggslETLSMMDYARAFAWPGGdmgLNMEATRANAVVMLDCKSIVEAFMVAE-RYKTF 236
                                   6789999*****************999988889999999977666999*****************9999999999.99999 PP

                                   -S.......EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSE CS
                         START  76 la.......kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvv 143
                                   ++         ++ +  s+g     ga +lm+ + +++sp vp ++ +f+Ry++ l+ g  +ivd+Sv  ++       + 
  Zpz_sc04310.1.g00020.1.sm.mk 237 FPgiitgatTDKVFNWPSNGdagydGAMVLMSVDVAFPSPFVPvKKCTFLRYCKMLEHGAVAIVDISVVDCEG--I---FY 312
                                   99999555544555555666*********************************************99988888..4...89 PP

                                   E-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                         START 144 RaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                   ++ + pSg+liep   + +kvt +ehv +++  +h+l++   +sgl +ga++wv  + rqc++
  Zpz_sc04310.1.g00020.1.sm.mk 313 KCCKKPSGLLIEPFRPNSCKVTAIEHVQVQDTGIHELFKEC-SSGLLFGARRWVMSMARQCAR 374
                                   999************************************96.689****************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.84E-1560122IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-1463122IPR009057Homeodomain-like
PROSITE profilePS5007113.60464124IPR001356Homeobox domain
SMARTSM003891.6E-1064128IPR001356Homeobox domain
CDDcd000862.15E-1267122No hitNo description
PfamPF000465.3E-1372122IPR001356Homeobox domain
PROSITE patternPS00027099122IPR017970Homeobox, conserved site
PROSITE profilePS5084820.046147377IPR002913START domain
SuperFamilySSF559619.2E-16150374No hitNo description
CDDcd088758.42E-71154373No hitNo description
SMARTSM002340.0028156374IPR002913START domain
PfamPF018524.5E-18157374IPR002913START domain
SuperFamilySSF559616.04E-6410572No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 639 aa     Download sequence    Send to blast
MEMRQGRAVP VSNTSEKSSK NEPEIPSASN GARALRYNEA ASSILREIEN IRKEGPNVGD  60
HGPQLKKKCF HRLTREQSDI LESFFITCPH PIEVQRNQLS QLTGLDGNQV KFWFQNKRTH  120
VKLARLISAA PSRAFQFQPS SEPVFVPQDD ARKLTEIARD AVRDLVTLAS SNGPLWICVP  180
GGSLETLSMM DYARAFAWPG GDMGLNMEAT RANAVVMLDC KSIVEAFMVA ERYKTFFPGI  240
ITGATTDKVF NWPSNGDAGY DGAMVLMSVD VAFPSPFVPV KKCTFLRYCK MLEHGAVAIV  300
DISVVDCEGI FYKCCKKPSG LLIEPFRPNS CKVTAIEHVQ VQDTGIHELF KECSSGLLFG  360
ARRWVMSMAR QCARIRDVTN VSSSSKSGSA MGRSTLEKMA DTLLANFVAG IIGLPAEDWI  420
IRCREGDEDD VVKIVLKRNG DGTDTATVCA SASFKLPVPM RRAFTLLKNN NLRGRWDALV  480
KGSSIKDEVR VANGVGDDDS ISVLHVKLDT AGGKETKMIL QNSSYDASGS LLVYASLDKQ  540
LMTDMIVNPG GNQDISDIPL FPSGIFLVPV PDAAQPTSAV GDAGEIVVTV GSQIVTKVAP  600
GTEAPELSAP ALSSVLKIMS DNIRNVIDTL VNSDPVLSI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660716.10.0PREDICTED: homeobox-leucine zipper protein TF1
TrEMBLK3XF210.0K3XF21_SETIT; Uncharacterized protein
STRINGSi000488m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104752833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.13e-64protodermal factor 2